You have no items in your shopping cart.
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Key Properties
−| Expression System | Escherichia coli |
|---|---|
| Biological Activity | Testing in progress. |
| Molecular Weight | Approximately 9.0 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids. |
| Protein Sequence | LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN |
| Purity | > 97 % by SDS-PAGE analyses. |
| Endotoxins | Less than 0.1 EU/ugof rHuCD59 as determined by LAL method. |
Storage & Handling
−| Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
|---|---|
| Form/Appearance | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0, with 1 mM DTT, 5 % trehalose. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Human CD59 Protein [orb2993716]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 9.8 KDa. Observed: 15-20 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 2
CD59 Rabbit Polyclonal Antibody [orb377981]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl, 30 μl - Item 1 of 2
- Item 1 of 2
Recombinant Human CD59 Protein, C-Fc [orb3152971]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
37.77 kDa
50 μg, 100 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human CD59 (orb1952504)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days