Recombinant Human CD24 Fc Chimera Protein, Insect Cells Derived

SKU: orb1952506

Description

Recombinant Human CD24 Fc Chimera Protein, Insect Cells Derived

Research Area

Immunology & Inflammation

Key Properties

• Expression System: Insect Cell
• Biological Activity: Testing in progress.
• Molecular Weight: The protein has a calculated MW of 30.4 kDa, containing 276 amino acids. The protein migrates as 40-50 kDa in SDS-PAGE under reducing condition due to glycosylation.
• Protein Sequence: AGMGMSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGIEGRMDEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Purity: > 95 % by SDS-PAGE analyses.
• Endotoxins: Less than 0.1 EU/ugof rHuCD24-Fc as determined by LAL method.

Storage & Handling

• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.
• Form/Appearance: Lyophilized from a 0.2 μm filtered concentrated solution in PBS.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only