You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1742790 |
---|---|
Category | Proteins |
Description | Recombinant Human C-type lectin domain family 4 member C(CLEC4C),partial (Active) |
Tag | N-terminal 6xHis-Myc-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE |
MW | 24.1 kDa |
Target | CLEC4C |
UniProt ID | Q8WTT0 |
Protein Sequence | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI; Expression Region: 45-213aa |
Protein Length | Partial |
Source | Mammalian cell |
Expression System | Expression Region: 45-213aa. Protein Length: Partial |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody. The EC50 is 7.658-12.99 ng/mL |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method |
Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Alternative names | Blood dendritic cell antigen 2; BDCA-2; C-type lec Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating