Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)

• Catalog Number: orb1742790
• Category: Proteins
• Description: Recombinant Human C-type lectin domain family 4 member C(CLEC4C),partial (Active)
• Tag: N-terminal 6xHis-Myc-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE
• MW: 24.1 kDa
• UniProt ID: Q8WTT0
• Protein Sequence: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI; Expression Region: 45-213aa
• Protein Length: Partial
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody. The EC50 is 7.658-12.99 ng/mL
• Expression Region: 45-213aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Alternative names: Blood dendritic cell antigen 2; BDCA-2; C-type lec
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2μg/mL can bind Anti-CLEC4C recombinant antibody, the EC50 is 7.658-12.99 ng/mL.