You have no items in your shopping cart.
Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal hFc1-tagged |
| Molecular Weight | 39.7 kDa |
| Expression Region | 356-455aa |
| Protein Length | Partial of Q9UIR0-1 |
| Protein Sequence | LKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial [orb2658165]
Greater than 85% as determined by SDS-PAGE.
77.6 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Human Butyrophilin-like protein 2 (BTNL2), partial [orb1881831]
Greater than 85% as determined by SDS-PAGE.
41.3 kDa
Mammalian cell
100 μg, 20 μg, 1 mgRecombinant Human Butyrophilin-like protein 2 (BTNL2), partial [orb1881832]
Greater than 85% as determined by SDS-PAGE.
40.5 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Human Butyrophilin-like protein 2 (BTNL2), partial [orb1785328]
Greater than 90% as determined by SDS-PAGE.
74.1 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Human Butyrophilin-like protein 2 (BTNL2), partial [orb2658583]
Greater than 95% as determined by SDS-PAGE.
50.0 kDa
Yeast
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial (orb2659517)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



