You have no items in your shopping cart.
Recombinant Human Azurocidin (CAP7)
Description
Images & Validation
−
Key Properties
−| Expression System | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 27-248 |
| Protein Length | 222 |
| Protein Sequence | IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGP |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxins | Not test |
Storage & Handling
−| Storage | Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human Azurocidin (AZU1) [orb1096320]
Greater than 85% as determined by SDS-PAGE.
32.6 kDa
Mammalian cell
20 μg, 100 μg, 1 mgRecombinant Human Azurocidin (CAP7) [orb3011352]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Azurocidin (CAP7), Biotinylated [orb3006429]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Azurocidin (CAP7), Biotinylated [orb3008894]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Azurocidin (CAP7) [orb3010122]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Azurocidin (CAP7) (orb3005197)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review