Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial

SKU: orb1646589

Description

Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial

Research Area

Epigenetics & Chromatin

Key Properties

• Expression System: E.coli
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Molecular Weight: 33.4 kDa
• Protein Sequence: SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM
• Purity: Greater than 85% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Tris-based buffer50% glycerol
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

B120 BRG1-associated factor 250 Short name: BAF250 BRG1-associated factor 250a Short name: BAF250A Osa homolog 1 Short name: hOSA1 SWI-like protein SWI,SNF complex protein p270 SWI,SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 hELD C1orf4, OSA1, SMARCF1

Quick Database Links

UniProt

O14497