You have no items in your shopping cart.
Active
Description
Images & Validation
−
Key Properties
−| Expression System | Escherichia coli |
|---|---|
| Biological Activity | Testing in progress. |
| Protein Sequence | LTVVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEP EEYL |
| Purity | > 96 % HPLC analyses. |
| Endotoxins | Less than 0.1 EU/ugof rHirudin as determined by LAL method. |
Storage & Handling
−| Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 °C as supplied.1 month, 2 to 8 °C under sterile conditions after reconstitution.3 months, -20 to -70 °C under sterile conditions after reconstitution. |
|---|---|
| Form/Appearance | Lyophilized from a 0.2 μm filtered solution of 20 mM PB, pH 7.0, containing 2 % mannitol. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Hirudin (orb1952518)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review