Cart summary

You have no items in your shopping cart.

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2(EBNA2),partial

SKU: orb1647778

Description

Recombinant Protein

Images & Validation

Key Properties

SourceYeast
Expression SystemYeast
ImmunogenExpression Region:247-454aa
TagN-terminal 6xHis-tagged and C-terminal Myc-tagged
Molecular Weight25.9 kDa
Protein SequenceSYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGR WRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPD ISPIHEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ
PurityGreater than 90% as determined by SDS-PAGE

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Buffer/PreservativesTris-based buffer, 50% glycerol
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2(EBNA2),partial (orb1647778)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 570.00
100 μg
$ 1,040.00
1 mg
$ 3,460.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry