You have no items in your shopping cart.
Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2(EBNA2),partial
SKU: orb1647778
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Expression System | Yeast |
| Immunogen | Expression Region:247-454aa |
| Tag | N-terminal 6xHis-tagged and C-terminal Myc-tagged |
| Molecular Weight | 25.9 kDa |
| Protein Sequence | SYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGR WRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPD ISPIHEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ |
| Purity | Greater than 90% as determined by SDS-PAGE |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Buffer/Preservatives | Tris-based buffer, 50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial [orb2658378]
Greater than 90% as determined by SDS-PAGE.
20.0 kDa
Yeast
1 mg, 100 μg, 20 μgRecombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial [orb2658916]
Greater than 85% as determined by SDS-PAGE.
25.1 kDa
E.coli
100 μg, 1 mg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2(EBNA2),partial (orb1647778)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
