Recombinant Enterovirus A71 Genome polyprotein, partial

SKU: orb1096064

Description

This Recombinant Enterovirus A71 Genome polyprotein, partial spans the amino acid sequence from region 1441-1497aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Epigenetics, Infectious Diseases

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.coli
• Biological Origin: Enterovirus A71
• Tag: Tag-Free
• Molecular Weight: 6.5 kDa
• Expression Region: 1441-1497aa
• Protein Length: Partial
• Protein Sequence: GPPKFKPIKISLEEKPAPDAISDLLASVDSEEVRQYCRDQGWIIPETPTNVERHLNR
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

Genome polyprotein [Cleaved into, P3, Protein 3AB, P2, P1, Capsid protein VP0(VP4-VP2), Capsid protein VP4(P1A)(Virion protein 4), Capsid protein VP2(P1B)(Virion protein 2), Capsid protein VP3(P1C)(Virion protein 3), Capsid protein VP1(P1D)(Virion protein 1), Protease 2A(P2A)(EC 3.4.22.29)(Picornain 2A)(Protein 2A), Protein 2B(P2B), Protein 2C(P2C)(EC 3.6.1.15), Protein 3A(P3A), Viral protein genome-linked(VPg)(Protein 3B)(P3B), Protein 3CD(EC 3.4.22.28), Protease 3C(P3C), RNA-directed RNA polymerase(RdRp)(EC 2.7.7.48)(3D polymerase)(3Dpol)(Protein 3D)(3D)]

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

F6KTB0