You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb2902774 |
|---|---|
| Category | Proteins |
| Description | Recombinant Dog CD40 ligand (CD40LG) |
| Tag | N-terminal 10xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MIETYSQTAPRSVATGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLYEDFVFMKTLQKCNKGEGSLSLLNCEEIKSQFEAFLKEIMLNNEMKKEENIAMQKGDQDPRIAAHVISEASSNPASVLRWAPKGYYTISSNLVSLENGKQLAVKRQGLYYVYAQVTFCSNRAASSQAPFVASLCLHSPSGTERVLLRAASSRGSSKPCGQQSIHLGGVFELHPGASVFVNVTDPSQVSHGTGFTSFGLLKL |
| Protein Length | Full Length |
| UniProt ID | O97626 |
| MW | 30.2 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Source | in vitro E.coli expression system |
| Biological Origin | Canis lupus familiaris (Dog) (Canis familiaris) |
| Expression Region | 1-260aa |
| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
| Alternative names | Tumor necrosis factor ligand superfamily member 5 |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
>90% as determined by SDS-PAGE. | |
16.67 kDa |
>90% as determined by SDS-PAGE. | |
44.04 kDa |
>90% as determined by SDS-PAGE. | |
18.00 kDa |
>90% as determined by SDS-PAGE. | |
16.67 kDa |
>90% as determined by SDS-PAGE. | |
44.04 kDa |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review