You have no items in your shopping cart.
Cart summary
Recombinant CXCL1 (C-C motif chemokine ligand 1), Mouse, AF
Catalog Number: orb1178994
| Catalog Number | orb1178994 |
|---|---|
| Category | Proteins |
| Description | Recombinant CXCL1 (C-C motif chemokine ligand 1), Mouse, AF |
| Tag | His-tag at the N-terminus |
| Reactivity | Mouse |
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5. |
| Purity | > 95% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Protein Sequence | NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK. |
| Tested applications | ELISA |
| Endotoxins | < 0.1 EU per 1 μg of the protein by the LAL method. |
| Source | Escherichia coli |
| Biological Activity | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is < 15 ng/mL. |
| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Alternative names | GRO-α: MGSAα, NAP-3, GRO1, KC (murine) |
| Note | For research use only |
| Entrez | 14825 |
