Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs (Active)

SKU: orb2666716

Description

This Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs spans the amino acid sequence from region 22-220aa. Purity: The purity information is not available for VLPs proteins.

Research Area

Cancer Biology

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Key Properties

• Source: Mammalian cell
• Biological Origin: Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 4.186-6.635 ng/mL.The VLPs is negative control.
• Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
• Molecular Weight: 22.6 kDa
• Expression Region: 22-220aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: LVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPSHYMARYSTSAPAISRGPSEYPTKNYV
• Purity: The purity information is not available for VLPs proteins.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Disclaimer: For research use only

Detected by Mouse anti-6*His monoclonal antibody.

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 μg/ml can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 4.186-6.635 ng/mL.The VLPs is negative control.

Quick Database Links

UniProt

A0A0D9SBX5