Recombinant CCL3 (C-C motif chemokine ligand 3), Human, AF

• Catalog Number: orb1179153
• Category: Proteins
• Description: Recombinant CCL3 (C-C motif chemokine ligand 3), Human, AF
• Tested applications: ELISA
• Reactivity: Human
• Tag: His-tag at the N-terminus
• Form/Appearance: Lyophilized
• Purity: > 98% as determined by SDS-PAGE. Ni-NTA chromatography.
• Entrez: 6348
• Protein Sequence: ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA.
• Source: Escherichia coli
• Biological Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is < 10 ng/mL.
• Endotoxins: < 0.1 EU per 1 μg of the protein by the LAL method.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Buffer/Preservatives: The protein was lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.
• Alternative names: MIP-1a: Macrophage Inflammatory Protein-1α, LD78α
• Note: For research use only
• Expiration Date: 6 months from date of receipt.