You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb2902924 |
|---|---|
| Category | Proteins |
| Description | Recombinant Bovine CD99 antigen-like protein 2(CD99L2) |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Protein Sequence | DTGGFRLEDAVEGTSSVKQRWDHVTTTTRRPGATRAPAKPAGPPAEDDFNLADALDDQNDRDHDRKKPSIGGGGFSDKDLEDIVGGGDYKPDKGKGGGQYGGGDNSDDSGMSAETGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSALQTQSTEPPPPEPPRI |
| Protein Length | full length protein |
| UniProt ID | A1A4K1 |
| Biological Origin | Bos taurus (Bovine) |
| Expression Region | 26-217 |
| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
| Alternative names | CD99 antigen-like protein 2, CD_antigen= CD99 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review