RCAN1 Rabbit Polyclonal Antibody

• Catalog Number: orb576690
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RCAN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RCAN1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 28kDa
• Target: RCAN1
• UniProt ID: P53805
• Protein Sequence: Synthetic peptide located within the following region: PVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEME
• NCBI: NP_004405
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CSP1, DSC1, RCN1, DSCR1, MCIP1, ADAPT78
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Human Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

RCAN1 antibody - middle region (orb576690) validated by WB using Mouse Brain at 1:500.

RCAN1 antibody - middle region (orb576690) validated by WB using MOUSE OSTEOCLASTS at 1:1000.

WB Suggested Anti-RCAN1 Antibody, Positive Control: Lane 1: 20 ug Wild type mouse, left ventricle, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti rabbit-HRP, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-RCAN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.