You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419316 |
---|---|
Category | Proteins |
Description | Recombinant Rat Lymphotactin active |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
Purity | > 97% as determined by SDS-PAGE and HPLC. |
Protein Sequence | VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG |
Protein Length | Full Length of Mature Protein |
UniProt ID | P51672 |
MW | 10.0 kDa |
Application notes | Tag Info: NO-taggedExpression Region: 22-114aaSequence Info: Full Length of Mature Protein |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | E.Coli |
Biological Origin | Rattus norvegicus (Rat) |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human XCR1 transfected murine BaF3 cells is less than 100 ng/ml, corresponding to a specific activity of > 1.0 ×104 IU/mg. |
Expression Region | 22-114aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | C motif chemokine 1, Small-inducible cytokine C1 |
Research Area | Immunology & Inflammation |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. | |
Escherichia Coli |