Rat XCL1 protein

• Catalog Number: orb419316
• Category: Proteins
• Description: Recombinant Rat Lymphotactin active
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• MW: 10.0 kDa
• UniProt ID: P51672
• Protein Sequence: VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG
• Protein Length: Full Length of Mature Protein
• Source: E.Coli
• Expression System: 22-114aa
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human XCR1 transfected murine BaF3 cells is less than 100 ng/ml, corresponding to a specific activity of ＞ 1.0 ×104 IU/mg.
• Expression Region: 22-114aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Alternative names: C motif chemokine 1, Small-inducible cytokine C1
• Note: For research use only
• Application notes: Tag Info: NO-taggedExpression Region: 22-114aaSequence Info: Full Length of Mature Protein
• Expiration Date: 6 months from date of receipt.

SDS-PAGE analysis of Rat XCL1 protein