You have no items in your shopping cart.
Cart summary
Item 1 of 1
Rat XCL1 protein
Catalog Number: orb419316
| Catalog Number | orb419316 |
|---|---|
| Category | Proteins |
| Description | Recombinant Rat Lymphotactin active |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P51672 |
| MW | 10.0 kDa |
| Application notes | Tag Info: NO-taggedExpression Region: 22-114aaSequence Info: Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.Coli |
| Biological Origin | Rattus norvegicus (Rat) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human XCR1 transfected murine BaF3 cells is less than 100 ng/ml, corresponding to a specific activity of ＞ 1.0 ×104 IU/mg. |
| Expression Region | 22-114aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | C motif chemokine 1, Small-inducible cytokine C1 |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Rat Lymphotactin Protein [orb610970]
Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
1 mg, 50 μg, 100 μgRecombinant Rat Lymphotactin protein(Xcl1) (Active) [orb1650491]
100 μg, 1 mg, 20 μg, 5 μg, 250 μg, 500 μg
