Rat Vegfa protein

Catalog Number: orb604448

Catalog Number	orb604448
Category	Proteins
Description	Recombinant Rat Vascular endothelial growth factor A(Vegfa)
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	26.1 kDa
UniProt ID	P16612
Protein Sequence	APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Protein Length	Full Length of Mature Protein
Source	E.coli
Biological Origin	Rattus norvegicus (Rat)
Expression Region	27-214aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Vascular permeability factor , VPF Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Purity:	> 95% by SDS-PAGE.
Source:	Recombinant Rat VEGFA/VEGF164 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Ala27-Arg190) of Rat VEGFA (Accession #NP_001274037.1) fused with an 6��His Tag at the C-terminus.

Sizes Available: 100 μg, 50 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	P. pastoris

Purity:	> 86%, determined by SDS-PAGE
Source:	This protein contains the rat VEGF 164 isoform (AAA41211.1) (Met 1-Arg 190) was expressed.