You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216242 |
---|---|
Category | Proteins |
Description | The Rat VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Rat VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Rat VEGF-A Specifications: (Molecular Weight: 20.6 kDa) (Amino Acid Sequence: APTTEGEQKA HEVVKFMDVY QRSYCRPIET LVDIFQEYPD EIEYIFKPSC VPLMRCAGCC NDEALECVPT SESNVTMQIM RIKPHQSQHI GEMSFLQHSR CECRPKKDRT KPEKKSVRGK GKGQKRKRKK SRFKSWSVHC EPCSERRKHL FVQDPQTCKC SCKNTDSRCK ARQLELNERT CRCDKPRR (188)) (Gene ID: 83785). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 20.6 kDa |
Target | VEGF-A |
Entrez | 83785 |
Protein Sequence | APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (188) |
Protein Length | 188 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
P. pastoris |
Greater than 90% as determined by SDS-PAGE. | |
26.1 kDa | |
E.coli |
Filter by Rating