Rat Sost protein

SKU: orb605090

Description

This Rat Sost protein spans the amino acid sequence from region 29-213aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Application Notes:
  Full Length of Mature Protein

Key Properties

• Source: E.coli
• Biological Origin: Rattus norvegicus (Rat)
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Expression Region: 29-213aa
• Protein Length: Full Length of Mature Protein
• MW: 28.0 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Sost, Sclerostin

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sost.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sost.

Quick Database Links

UniProt

Q99P67