Rat p53 protein

SKU: orb245624

Description

This Rat p53 protein spans the amino acid sequence from region 1-391aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Apoptotic, Cancer, Epigenetics, Neuroscience, Signaling Pathways

Images & Validation

• Application Notes:
  This is His-tag protein

Key Properties

• Source: E.coli
• Biological Origin: Rattus norvegicus (Rat)
• Tag: N-terminal 6xHis-tagged
• Molecular Weight: 47.5 kDa
• Expression Region: 1-391aa
• Protein Length: Full Length
• Protein Sequence: MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

BCC7 protein, FLJ92943 protein, HGNC11998 protein, LFS1 protein, p53 protein, p53 Cellular Tumor Antigen protein, p53 tumor suppressor protein, Phosphoprotein p53 protein, Tp53 protein, TRP53 protein, Tumor protein 53 protein, Tumor protein p53 protein, TP53 protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P10361