You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb418858 |
---|---|
Category | Proteins |
Description | Recombinant Rat Glucagon-like peptide 1 receptor |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 15.1 kDa |
UniProt ID | P32301 |
Protein Sequence | GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN |
Protein Length | Partial |
Source | Yeast |
Biological Origin | Rattus norvegicus (Rat) |
Expression Region | 22-135aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Glp1r, GlprGlucagon-like peptide 1 receptor, GLP-1 Read more... |
Note | For research use only |
Application notes | Tag Info: N-terminal 6xHis-taggedExpression Region: 22-135aaSequence Info: Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.The reducing (R) protein migrates as 60 kDa in SDS-PAGE may be due to glycosylation.Recommended Product
Greater than 90% as determined by SDS-PAGE. | |
17.1 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
15.6 kDa | |
Baculovirus |
Greater than 90% as determined by SDS-PAGE. | |
16.3 kDa | |
Yeast |
98.00% | |
17.1 kDa (predicted) |