You have no items in your shopping cart.
Cart summary
Item 1 of 1
Rat Fgf2 protein
Catalog Number: orb594771
| Catalog Number | orb594771 |
|---|---|
| Category | Proteins |
| Description | Recombinant Rat Fibroblast growth factor 2(Fgf2),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Protein Length | Partial |
| UniProt ID | P13109 |
| MW | 16.2 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.coli |
| Biological Origin | Rattus norvegicus (Rat) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 0.3-1.8 ng/ml. |
| Expression Region | 11-154aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Fibroblast Growth Factor 2; FGF-2; Basic Fibroblas Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Rat FGF2 protein [orb707319]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
10 μg, 50 μg, 500 μgRat FGF2 protein [orb754115]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
16 kDa
E.Coli
1 mg, 200 μg, 100 μg, 50 μgRecombinant rat FGF Basic/FGF-2/Fgf2 Protein, No Tag [orb1552411]
≥90% as determined by SDS-PAGE
This protein contains the rat FGF2(Ala11-Ser154) was fused without Tag and expressed in E. coli.
100 μg, 50 μgRecombinant Human Syndecan-4 (rHuSDC-4) [orb1495076]
> 90% by SDS-PAGE and HPLC analyses.
Approximately 15.4 kDa, a single non-glycosylated polypeptide chain containing 134amino acids with 6×His at C-terminus.
Escherichia coli.
1 mg, 50 μg, 10 μg
