You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594771 |
---|---|
Category | Proteins |
Description | Recombinant Rat Fibroblast growth factor 2(Fgf2),partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Protein Length | Partial |
UniProt ID | P13109 |
MW | 16.2 kDa |
Application notes | Partial |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | E.coli |
Biological Origin | Rattus norvegicus (Rat) |
Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 0.3-1.8 ng/ml. |
Expression Region | 11-154aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Fibroblast Growth Factor 2; FGF-2; Basic Fibroblas Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
16 kDa | |
E.Coli |
≥90% as determined by SDS-PAGE | |
This protein contains the rat FGF2(Ala11-Ser154) was fused without Tag and expressed in E. coli. |
> 90% by SDS-PAGE and HPLC analyses. | |
Approximately 15.4 kDa, a single non-glycosylated polypeptide chain containing 134amino acids with 6×His at C-terminus. | |
Escherichia coli. |