You have no items in your shopping cart.
Rat Fgf2 protein
SKU: orb594771
Featured
Description
Research Area
Signal Transduction
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Rattus norvegicus (Rat) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 0.3-1.8 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 16.2 kDa |
| Expression Region | 11-154aa |
| Protein Length | Partial |
| Protein Sequence | ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB
Similar Products
−Rat FGF2 protein [orb754115]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
16 kDa
E.Coli
50 μg, 200 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Rat Fgf2 protein (orb594771)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

