Cart summary

You have no items in your shopping cart.

    Rat Dio2 protein

    Rat Dio2 protein

    Catalog Number: orb246045

    DispatchUsually dispatched within 5-6 weeks
    $ 2,408.00
    Catalog Numberorb246045
    CategoryProteins
    DescriptionRecombinant rat Type II iodothyronine deiodinase
    TagN-terminal 6xHis-tagged
    Form/AppearanceLiquid or Lyophilized powder
    PurityGreater than 90% as determined by SDS-PAGE.
    MW31.8 kDa
    UniProt IDP70551
    Protein SequenceMGLLSVDLLITLQILPVFFSNCLFLALYDSVILLKHVALLLSRSKSTRGEWRRMLTSEGLRCVWNSFLLDAYKQVKLGEDAPNSSVVHVSNPEAGNNCASEKTADGAECHLLDFASAERPLVVNFGSATUPPFTRQLPAFRQLVEEFSSVADFLLVYIDEAHPSDGWAVPGDSSMSFEVKKHRNQEDRCAAAHQLLERFSLPPQCQVVADRMDNNANVAYGVAFERVCIVQRRKIAYLGGKGPFSYNLQEVRSWLEKNFSKRUILD
    Protein LengthFull Length
    SourceYeast
    Expression SystemExpression Region: 1-266aa. Protein Length: Full Length
    Expression Region1-266aa
    EndotoxinsNot test.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
    Alternative namesDio2
    Read more...
    NoteFor research use only
    Application notesThis is His-tag protein
    Expiration Date6 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars