Cart summary

You have no items in your shopping cart.

Rat Dio2 protein

Catalog Number: orb246045

DispatchUsually dispatched within 5-6 weeks
$ 360.00
Catalog Numberorb246045
CategoryProteins
DescriptionRecombinant rat Type II iodothyronine deiodinase
TagN-terminal 6xHis-tagged
Form/AppearanceLiquid or Lyophilized powder
Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
PurityGreater than 90% as determined by SDS-PAGE.
Protein SequenceMGLLSVDLLITLQILPVFFSNCLFLALYDSVILLKHVALLLSRSKSTRGEWRRMLTSEGLRCVWNSFLLDAYKQVKLGEDAPNSSVVHVSNPEAGNNCASEKTADGAECHLLDFASAERPLVVNFGSATUPPFTRQLPAFRQLVEEFSSVADFLLVYIDEAHPSDGWAVPGDSSMSFEVKKHRNQEDRCAAAHQLLERFSLPPQCQVVADRMDNNANVAYGVAFERVCIVQRRKIAYLGGKGPFSYNLQEVRSWLEKNFSKRUILD
Protein LengthFull Length
UniProt IDP70551
MW31.8 kDa
Application notesThis is His-tag protein
EndotoxinsNot test.
SourceYeast
Biological OriginRattus norvegicus (Rat)
Expression Region1-266aa
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative namesDio2
NoteFor research use only
Rat Dio2 protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.