Cart summary

You have no items in your shopping cart.

Rat Dio2 protein

SKU: orb246045

Description

This Rat Dio2 protein spans the amino acid sequence from region 1-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Epigenetics

Images & Validation

Application Notes
This is His-tag protein

Key Properties

SourceYeast
Biological OriginRattus norvegicus (Rat)
TagN-terminal 6xHis-tagged
Molecular Weight31.8 kDa
Expression Region1-266aa
Protein LengthFull Length
Protein SequenceMGLLSVDLLITLQILPVFFSNCLFLALYDSVILLKHVALLLSRSKSTRGEWRRMLTSEGLRCVWNSFLLDAYKQVKLGEDAPNSSVVHVSNPEAGNNCASEKTADGAECHLLDFASAERPLVVNFGSATUPPFTRQLPAFRQLVEEFSSVADFLLVYIDEAHPSDGWAVPGDSSMSFEVKKHRNQEDRCAAAHQLLERFSLPPQCQVVADRMDNNANVAYGVAFERVCIVQRRKIAYLGGKGPFSYNLQEVRSWLEKNFSKRUILD
PurityGreater than 90% as determined by SDS-PAGE.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLiquid or Lyophilized powder
Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Dio2

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Rat Dio2 protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Rat Dio2 protein (orb246045)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 330.00
100 μg
$ 600.00
1 mg
$ 2,500.00
DispatchUsually dispatched within 5-6 weeks
Bulk Enquiry