You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Rattus norvegicus (Rat) |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using rat neutrophils is in a concentration range of 10-100 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 28-100aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 7.9 kDa |
| Purity | > 98% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Cytokine-induced neutrophil chemoattractant 3, Macrophage inflammatory protein 2, MIP2
Similar Products
−RecombinantGRO-β/MIP-2/CXCL2,Rat [orb1494850]
>98% by SDS-PAGE and HPLC analyses.
Approximately 7.9 kDa, a single, non-glycosylated polypeptide chain containing 73 amino acids.
Escherichia coli.
1 mg, 5 μg, 25 μgRecombinantGRO-β/CINC-3/CXCL2,Rat [orb1494851]
> 95% as analyzed by SDS-PAGE.
7.6 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
1 mg, 5 μg, 25 μgRecombinant Rat C-X-C motif chemokine 2 protein(Cxcl2) (Active) [orb1650764]
>98% as determined by SDS-PAGE and HPLC.
7.9 kDa
1 mg, 500 μg, 250 μg, 100 μg, 25 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

