You have no items in your shopping cart.
Rat CXCL2 protein (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Rattus norvegicus (Rat) |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using rat neutrophils is in a concentration range of 10-100 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 7.9 kDa |
| Expression Region | 28-100aa |
| Protein Length | Partial |
| Protein Sequence | VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN |
| Purity | > 98% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RecombinantGRO-β/MIP-2/CXCL2,Rat [orb1494850]
>98% by SDS-PAGE and HPLC analyses.
Approximately 7.9 kDa, a single, non-glycosylated polypeptide chain containing 73 amino acids.
Escherichia coli.
5 μg, 25 μg, 1 mgRecombinantGRO-β/CINC-3/CXCL2,Rat [orb1494851]
> 95% as analyzed by SDS-PAGE.
7.6 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
5 μg, 25 μg, 1 mgRecombinant Rat C-X-C motif chemokine 2 protein(Cxcl2) (Active) [orb1650764]
>98% as determined by SDS-PAGE and HPLC.
7.9 kDa
500 μg, 1 mg, 5 μg, 25 μg, 250 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Rat CXCL2 protein (Active) (orb359122)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review