You have no items in your shopping cart.
Rat CCL6 protein (Active)
SKU: orb359135
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Rattus norvegicus (Rat) |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-100 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 10.4 kDa |
| Expression Region | 22-115aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Small-inducible cytokine A6,
Similar Products
−Recombinant Rat C-C motif chemokine 6 protein(Ccl6) (Active) [orb1650789]
>97% as determined by SDS-PAGE and HPLC.
10.4 kDa
100 μg, 500 μg, 1 mg, 10 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Rat CCL6 protein (Active) (orb359135)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review