Cart summary

You have no items in your shopping cart.

RASSF2 Peptide - middle region

RASSF2 Peptide - middle region

Catalog Number: orb1998356

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998356
CategoryProteins
DescriptionRASSF2 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQ
UniProt IDP50749
MW37 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesCENP-34, RASFADIN
NoteFor research use only
NCBINP_055552.1