You have no items in your shopping cart.
Cart summary
RASA4 Peptide - middle region
Catalog Number: orb2000994
| Catalog Number | orb2000994 |
|---|---|
| Category | Proteins |
| Description | RASA4 Peptide - middle region |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 88 kDa |
| UniProt ID | O43374 |
| Protein Sequence | Synthetic peptide located within the following region: EEGWFRLQPDQSKSRRHDEGNLGSLQLEVRLRDETVLPSSYYQPLVHLLC |
| NCBI | NP_001073346.2 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | GAPL, CAPRI Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with RASA4 Rabbit Polyclonal Antibody (orb588751). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
