RAP1GDS1 Rabbit Polyclonal Antibody

• Catalog Number: orb584404
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RAP1GDS1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAP1GDS1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: RAP1GDS1
• UniProt ID: P52306
• Protein Sequence: Synthetic peptide located within the following region: LLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQ
• NCBI: NP_001093899
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GDS1, SmgGDS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. RAP1GDS1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

WB Suggested Anti-RAP1GDS1 Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.