RAD51 Peptide - N-terminal region

SKU: orb2002813

This product can be custom made

Description

Research Area

Epigenetics & Chromatin

Images & Validation

−

Tested Applications	WB
Application Notes	This is a synthetic peptide designed for use in combination with RAD51 Rabbit Polyclonal Antibody (orb573908). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

−

Protein Sequence	Synthetic peptide located within the following region: QLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYA

Storage & Handling

−

Storage	Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized powder
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Name=RAD51,

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

Q06609

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols