Cart summary

You have no items in your shopping cart.

RAC1 Rabbit Polyclonal Antibody

SKU: orb330944

Description

Rabbit polyclonal antibody to RAC1

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Neuroscience, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RAC1
TargetRAC1
Protein SequenceSynthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Molecular Weight23 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-p21 Rac1 antibody, anti-p21-Rac1 antibody, anti-Rac 1 antibody, anti-RAC1 antibody, anti-RAC1_HUMAN antibody, anti-Ras like protein TC25 antibody, anti-Ras related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) antibody, anti-Ras-like protein TC25 antibody, anti-Ras-related C3 botulinum toxin substrate 1 antibody

Similar Products

  • PAK3 Rabbit Polyclonal Antibody [orb10209]

    IF,  IHC-Fr,  IHC-P

    Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • PAK1 Rabbit Polyclonal Antibody [orb101431]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Mouse, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • RAC1+RAC2 Rabbit Polyclonal Antibody [orb100907]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Guinea pig, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • Phospho-PAK1 (Ser144) + PAK3 (Ser154) Rabbit Polyclonal Antibody [orb11227]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Rac1 Rabbit Polyclonal Antibody [orb259608]

    ICC,  IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RAC1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

RAC1 Rabbit Polyclonal Antibody

Sample Type: Lane 1: 20 ug siRUVBL1 transfected human H1299 cells, Lane 2: 20 ug untransfected human H1299 cells Primary Antibody dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:3000 Color/Signal Descriptions: RAC1.

RAC1 Rabbit Polyclonal Antibody

WB Suggested Anti-RAC1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_008839

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

RAC1 Rabbit Polyclonal Antibody (orb330944)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry