RAC1 Rabbit Polyclonal Antibody

• Catalog Number: orb330944
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RAC1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAC1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 23 kDa
• Target: RAC1
• UniProt ID: P63000
• Protein Sequence: Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
• NCBI: NP_008839
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Anti-p21 Rac1 antibody, anti-p21-Rac1 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

Sample Type: Lane 1: 20 ug siRUVBL1 transfected human H1299 cells, Lane 2: 20 ug untransfected human H1299 cells Primary Antibody dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:3000 Color/Signal Descriptions: RAC1.

WB Suggested Anti-RAC1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.