Rabbit TFPI protein

• Catalog Number: orb605252
• Category: Proteins
• Description: This Rabbit TFPI protein spans the amino acid sequence from region 25-300aa. Purity: Greater than 95% as determined by SDS-PAGE.
• Tag: N-terminal 10xHis-tagged
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT
• Protein Length: Full Length of Mature Protein
• UniProt ID: P19761
• MW: 35.4 kDa
• Application notes: Full Length of Mature Protein
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Source: Mammalian cell
• Biological Origin: Oryctolagus cuniculus (Rabbit)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL.
• Expression Region: 25-300aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: (TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipopr
• Research Area: Cardiovascular Research
• Note: For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/ml can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL.