Cart summary

You have no items in your shopping cart.

RAB36 Peptide - middle region

RAB36 Peptide - middle region

Catalog Number: orb1998720

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998720
CategoryProteins
DescriptionRAB36 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: FDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEA
UniProt IDO95755
MW36 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
NoteFor research use only
NCBINP_004905.2