Rab32 Antibody

• Catalog Number: orb11624
• Category: Antibodies
• Description: Goat polyclonal antibody to Rab32. Rab32 belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and involved in intracellular vesicle transport and small GTPase mediated signal transduction.
• Target: RAB32, member RAS oncogene family
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Purification: Epitope affinity purified
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a produced in E. coli.. Antigen Sequence: KNDLDSKVHLPNGSPIPAVLLANKCDQKKDNSQSPSQMDQFCKDHGFTGWFETSAKDNINIDEATRFLVENMLANQQSFPSEEIDLDRIKLVEEPPTTKPRSQCC
• Tested applications: IF, WB
• Dilution range: WB:1:500-1:2,000, IF:1:100-1:500
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only

Western blot analysis of Melan-ink cell lysate using Rab32 antibody

Confocal immunofluorescence analysis of macrophages using Rab32 antibody