You have no items in your shopping cart.
RAB14 Peptide - C-terminal region
SKU: orb1997754
Description
Images & Validation
−
Key Properties
−| Molecular Weight | 23 kDa |
|---|---|
| Protein Sequence | Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG |
Storage & Handling
−| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Disclaimer | For research use only |
Alternative Names
−AI314285, AI649155, 0610030G24Rik, 2810475J17Rik, A830021G03Rik, D030017L14Rik
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
RefSeq (Protein):NP_080973.1
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_080973.1 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
RAB14 Peptide - C-terminal region (orb1997754)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days