RAB14 Rabbit Polyclonal Antibody

• Catalog Number: orb592816
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RAB14
• Target: RAB14
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Goat, Mouse, Porcine, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RAB14
• Protein Sequence: Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG
• UniProt ID: P61106
• MW: 24kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FBP, RAB-14
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_057406

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. There is BioGPS gene expression data showing that RAB14 is expressed in HepG2.

Lanes: Murin JAWS-II cell line Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody Dilution: 1:1000.

WB Suggested Anti-RAB14 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that RAB14 is expressed in HepG2.