PYY Antibody Blocking Peptide

SKU: orb73354

Description

This product is PYY Antibody Blocking Peptide. Its protein sequence is YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2. It targets Peptide YY. Purification is performed using HPLC.

Research Area

Hormone Research, Obesity

Images & Validation

−

Key Properties

−

Target	Peptide YY
Purification	HPLC
Protein Sequence	YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

Storage & Handling

−

Storage	Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Form/Appearance	Lyophilized
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

RATGHYY; GHYY; MGC19143; Peptide tyrosine tyrosine; peptide YY; Peptide YY like; Peptide YY precursor; PYY 1; PYY; PYY II; PYY1; PYYI; Yy; PYY_HUMAN.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Peptide YY

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols