You have no items in your shopping cart.
PTOV1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PTOV1 |
| Target | PTOV1 |
| Protein Sequence | Synthetic peptide located within the following region: DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN |
| Molecular Weight | 47kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PTOV1 Rabbit Polyclonal Antibody [orb158227]
IF, IHC-Fr, IHC-P, WB
Mouse, Rat
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlPTOV1 Rabbit Polyclonal Antibody (HRP) [orb2111489]
IHC, WB
Bovine, Canine, Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
HRP
100 μlPTOV1 Rabbit Polyclonal Antibody (FITC) [orb2111490]
IHC, WB
Bovine, Canine, Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
FITC
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: 721_B Whole Cell lysates, Antibody dilution: 0.5 ug/ml.

Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 0.5 ug/ml.

Rabbit Anti-PTOV1 Antibody, Catalog Number: orb581142, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes and processes of intersticial cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PTOV1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. PTOV1 is supported by BioGPS gene expression data to be expressed in Jurkat.
Documents Download
Request a Document
Protocol Information
PTOV1 Rabbit Polyclonal Antibody (orb581142)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review









