PTOV1 Rabbit Polyclonal Antibody

• Catalog Number: orb581142
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PTOV1
• Target: PTOV1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTOV1
• Protein Sequence: Synthetic peptide located within the following region: DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN
• UniProt ID: Q86YD1
• MW: 47kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ACID2, PTOV-1
• Note: For research use only
• NCBI: NP_059128
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: 721_B Whole Cell lysates, Antibody dilution: 0.5 ug/ml.

Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 0.5 ug/ml.

Rabbit Anti-PTOV1 Antibody, Catalog Number: orb581142, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes and processes of intersticial cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PTOV1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. PTOV1 is supported by BioGPS gene expression data to be expressed in Jurkat.