You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2694577 |
---|---|
Category | Proteins |
Description | pTH (3-34) (bovine) is apTH ((Human parathyroid hormone) fragment. |
CAS Number | 51257-86-4 |
Purity | ≥95% |
MW | 3938.55 |
Formula | C175H274N52O48S2 |
Target | Thyroid Hormone Receptor |
Protein Sequence | SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
98.00% | |
64297-16-1 | |
3917.44 | |
C177H279N53O48 |