Cart summary

You have no items in your shopping cart.

PSEN1 Peptide - N-terminal region

PSEN1 Peptide - N-terminal region

Catalog Number: orb1998635

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998635
CategoryProteins
DescriptionPSEN1 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: GNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFY
UniProt IDP49768
MW53 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesAD3, FAD, PS1, PS-1, S182
NoteFor research use only
NCBINP_000012.1