Prolactin Releasing Peptide (1-31), HumanPrRP-31

SKU: orb2693760

Description

Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis.

Images & Validation

−

Key Properties

−

Target	GnRH Receptor
CAS Number	215510-22-8
MW	3664.2
Purity	≥95%
Formula	C₁₆₀H₂₅₂N₅₆O₄₂S
Protein Sequence	SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

GnRH Receptor

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols