Cart summary

You have no items in your shopping cart.

PROKR2 Rabbit Polyclonal Antibody (Biotin)

PROKR2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2092930

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2092930
CategoryAntibodies
DescriptionPROKR2 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW44kDa
UniProt IDQ8NFJ6
Protein SequenceSynthetic peptide located within the following region: CFVTVKNNTMKYFKKMMLLHWRPSQRGSKSSADLDLRTNGVPTTEEVDCI
NCBINP_658986
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesHH3, KAL3, PKR2, GPRg2, GPR73b, GPR73L1, dJ680N4.3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.