You have no items in your shopping cart.
Preprogalanin 28-67, rat
SKU: orb2694070
Description
Images & Validation
−
Key Properties
−| Molecular Weight | 4489.08 |
|---|---|
| Protein Sequence | TKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELP |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Preprogalanin 28-67, rat (orb2694070)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review