You have no items in your shopping cart.
Pramlintide peptide
SKU: orb423190
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Protein Sequence | KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 |
|---|---|
| Purity | Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The protein was lyophilized with no additives. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Pramlintide peptide (orb423190)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review