You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326422 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PPP6R3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 92kDa |
Target | PPP6R3 |
UniProt ID | Q5H9R7 |
Protein Sequence | Synthetic peptide located within the following region: PSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQ |
NCBI | NP_060782 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti C11orf23 antibody, anti DKFZp781E17107 antibo Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-PPP6R3 Antibody, Titration: 1.0 ug/mL, Positive Control: 721_B Whole Cell, PPP6R3 is supported by BioGPS gene expression data to be expressed in 721_B.
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Recombinant | |
Unconjugated |
Filter by Rating