Cart summary

You have no items in your shopping cart.

PPP4R3A Rabbit Polyclonal Antibody (FITC)

PPP4R3A Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2101227

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2101227
CategoryAntibodies
DescriptionPPP4R3A Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SMEK1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW94kDa
UniProt IDQ6IN85
Protein SequenceSynthetic peptide located within the following region: YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR
NCBINP_115949
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namessmk1, FLFL1, PP4R3, SMEK1, smk-1, PP4R3A, MSTP033,
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.