You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330843 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PPP2R3A |
Target | PPP2R3A |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R3A |
Protein Sequence | Synthetic peptide located within the following region: SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD |
UniProt ID | Q06190 |
MW | 130kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti PPP2R3 antibody, anti PR130 antibody, anti PR Read more... |
Note | For research use only |
NCBI | NP_002709 |
Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/ml using anti-PPP2R3A antibody (orb330843).
WB Suggested Anti-PPP2R3A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Canine, Equine, Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Canine, Equine, Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy5 |
IHC-Fr, IHC-P, WB | |
Canine, Equine, Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
AP |
IF | |
Canine, Equine, Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE/Cy7 |