POTEA Peptide - C-terminal region

• Catalog Number: orb2003540
• Category: Proteins
• Description: POTEA Peptide - C-terminal region
• Predicted Reactivity: Human
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: Synthetic peptide located within the following region: EKVTQEPDINKDCDREVEEEMQKHGSNNVGLSENLTDGAAAGNGDGGLVP
• UniProt ID: Q6S8J7
• MW: 56kDa
• Tested applications: WB
• Application notes: This is a synthetic peptide designed for use in combination with POTEA Rabbit Polyclonal Antibody (orb587711). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: A26A1, CT104.3, POTE-8, POTE8
• Note: For research use only
• NCBI: NP_001005365
• Expiration Date: 6 months from date of receipt.