Porcine Trypsin Protein

• Catalog Number: orb429008
• Category: Proteins
• Description: Recombinant of porcine Trypsin protein
• Form/Appearance: Sterile Filtered lyophilized powder.
• Buffer/Preservatives: The Porcine Trypsin was lyophilized with mannitol as preservative.
• Protein Sequence: VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN
• Application notes: Applications: Trypsin digestion: the suggested ratio is 1:50 to 1:1000 (w/w). Unit Definition: One USP unit of trypsin activity will produce a Delta A253 of 0.003 per minute in a reaction volume of 3.0ml at pH7.6 and 25°C, with BAEE as a substrate (1cm light path)
• Source: E.coli
• Biological Activity: 4500 USP units/mg protein.
• Solubility (25°C): It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Storage: Stability: Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles
• Note: For research use only
• Expiration Date: 6 months from date of receipt.