You have no items in your shopping cart.
Porcine Trypsin Protein
SKU: orb429008
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Activity | 4500 USP units/mg protein. |
| Protein Sequence | VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN |
Storage & Handling
−| Storage | Stability: Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered lyophilized powder. |
| Buffer/Preservatives | The Porcine Trypsin was lyophilized with mannitol as preservative. |
| Disclaimer | For research use only |
Similar Products
−Pig ITIH4 ELISA Kit [orb409866]
Porcine
37.5 ng/mL-2400 ng/mL
9.38 ng/mL
24 T, 48 T, 10 x 96 T, 5 x 96 T, 96 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Porcine Trypsin Protein (orb429008)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review