Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Porcine Trypsin protein
Catalog Number orb429008
ReactivityPorcine
ConjugationUnconjugated
Target Trypsin
Product Properties
Form/Appearance Sterile Filtered clear liquid solution.
The Porcine Trypsin (2.98mg/ml) is formulated with 1mM HCl and 20mM CaCl2, pH-3.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN.
Source Pichia Pastoris.
Activity 3,394 BAEE units/mg powder.
Product Description

Recombinant of porcine Trypsin protein

Reviews
Write Your Own Review
You're reviewing:Porcine Trypsin protein - orb429008
Your Rating