Cart summary

You have no items in your shopping cart.

Porcine Trypsin Protein

SKU: orb429008

Description

Recombinant of porcine Trypsin protein

Images & Validation

Application Notes
Applications: Trypsin digestion: the suggested ratio is 1:50 to 1:1000 (w/w). Unit Definition: One USP unit of trypsin activity will produce a Delta A253 of 0.003 per minute in a reaction volume of 3.0ml at pH7.6 and 25°C, with BAEE as a substrate (1cm light path)

Key Properties

SourceE.coli
Biological Activity4500 USP units/mg protein.
Protein SequenceVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN

Storage & Handling

StorageStability: Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered lyophilized powder.
Buffer/PreservativesThe Porcine Trypsin was lyophilized with mannitol as preservative.
DisclaimerFor research use only

Similar Products

  • Pig ITIH4 ELISA Kit [orb409866]

    Porcine

    37.5 ng/mL-2400 ng/mL

    9.38 ng/mL

    48 T, 24 T, 10 x 96 T, 96 T, 5 x 96 T
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Porcine Trypsin Protein (orb429008)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

1 mg
$ 250.00
2.5 mg
$ 350.00
50 mg
$ 1,310.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry