Porcine TNF alpha protein

• Catalog Number: orb1216340
• Category: Proteins
• Description: The Swine TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Swine TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086).
• Target: TNF alpha
• Form/Appearance: Lyophilized
• Purity: 98%
• Protein Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL
• Protein Length: 154
• MW: 16.9 kDa
• Source: Yeast
• Biological Origin: Swine
• Storage: -20°C
• Alternative names: TNFSF2
• Note: For research use only