Porcine IL-1 beta protein

Catalog Number: orb1216291

Catalog Number	orb1216291
Category	Proteins
Description	The Swine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-1 beta Specifications: (Molecular Weight: 17.6 kDa) (Amino Acid Sequence: ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153)) (Gene ID: 397122).
Form/Appearance	Lyophilized
Purity	98%
MW	17.6 kDa
Target	IL-1 beta
Entrez	397122
Protein Sequence	ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153)
Protein Length	153
Source	Yeast
Storage	-20°C
Alternative names	IL-1F2 Read more...
Note	For research use only
Expiration Date	6 months from date of receipt.

Purity:	Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
MW:	18 kDa

Applications:	ELISA, WB
Purity:	Greater than 95% by SDS-PAGE gel analyses
MW:	17.5 KDa
Source:	E.Coli