Porcine IL-1 beta protein

SKU: orb1216291

Description

The Swine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-1 beta Specifications: (Molecular Weight: 17.6 kDa) (Amino Acid Sequence: ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153)) (Gene ID: 397122).

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Swine
Target	IL-1 beta
Molecular Weight	17.6 kDa
Protein Length	153.0
Protein Sequence	ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153)
Purity	98%

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Disclaimer	For research use only

Alternative Names

−

IL-1F2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

IL-1 beta

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols