You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216291 |
---|---|
Category | Proteins |
Description | The Swine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-1 beta Specifications: (Molecular Weight: 17.6 kDa) (Amino Acid Sequence: ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153)) (Gene ID: 397122). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 17.6 kDa |
Target | IL-1 beta |
Entrez | 397122 |
Protein Sequence | ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153) |
Protein Length | 153 |
Source | Yeast |
Storage | -20°C |
Alternative names | IL-1F2 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
HPLC, SDS-PAGE | |
Unconjugated | |
> 95 % by SDS-PAGE and HPLC analyses | |
17.6 kDa |
Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
18 kDa |
ELISA, WB | |
Greater than 95% by SDS-PAGE gel analyses | |
17.5 KDa | |
E.Coli |
Filter by Rating