You have no items in your shopping cart.
Cart summary
Porcine IL-1 beta protein
Catalog Number: orb1216291
| Catalog Number | orb1216291 |
|---|---|
| Category | Proteins |
| Description | The Swine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-1 beta Specifications: (Molecular Weight: 17.6 kDa) (Amino Acid Sequence: ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153)) (Gene ID: 397122). |
| Target | IL-1 beta |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153) |
| Protein Length | 153 |
| MW | 17.6 kDa |
| Source | Yeast |
| Biological Origin | Swine |
| Storage | -20°C |
| Alternative names | IL-1F2 |
| Note | For research use only |
- Item 1 of 1
Porcine IL-1 beta protein [orb107741]
HPLC, SDS-PAGE
Unconjugated
> 95 % by SDS-PAGE and HPLC analyses
17.6 kDa
10 μg, 100 μg, 500 μg Porcine IL 1 beta Protein [orb80409]
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
1 mg, 2 μg, 10 μgPorcine IL-1b protein [orb633356]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
17.5 KDa
E.Coli
1 mg, 200 μg, 100 μg, 50 μg
